« Back
Home /
Recombinant Kallikrein 2 (KLK2)

Recombinant Kallikrein 2 (KLK2)

Item no.	RPD108Hu02-10ug
Manufacturer	Cloud-Clone
Amount	10 ug
Quantity options	100 ug 10 ug 1 mg 200 ug 500 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Applications	WB, SDS-PAGE, other
Specific against	Human (Homo sapiens)
Host	E.coli
Conjugate/Tag	HIS
Purity	> 90%
Sequence	EQKLISEEDL+Pro19ca.Pro261
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KLK2A2; HK2; Prostatic Kallikrein-Related Peptidase 2; Glandular kallikrein-1; Tissue kallikrein-2
Similar products	HK2, Glandular kallikrein-1, Tissue kallikrein-2, KLK2A2, Prostatic Kallikrein-Related Peptidase 2
Available
Sequence	EQKLISEEDL+Pro19ca.Pro261
Predicted Molecular Mass(KD)	30.6kDa
Purity	> 90%
Uniprot Link	P20151
Subcellular location	PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Isoelectric Point	7, 1
Item Name	Kallikrein 2
Alternative Names	KLK2A2, HK2, Prostatic Kallikrein-Related Peptidase 2, Glandular kallikrein-1, Tissue kallikrein-2
Buffer	PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Traits	Freeze-dried powder
Tag	N-terminal His Tag
Research Area	Enzyme & Kinase;
Expression System	Prokaryotic expression
Appilcaiton info	Positive Control, Immunogen, SDS-PAGE, WB.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.