Item no. |
RPD108Hu02-200ug |
Manufacturer |
Cloud-Clone
|
Amount |
200 ug |
Quantity options |
100 ug
10 ug
1 mg
200 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins |
Applications |
WB, SDS-PAGE, other |
Specific against |
Human (Homo sapiens) |
Host |
E.coli |
Conjugate/Tag |
HIS |
Purity |
> 90% |
Sequence |
EQKLISEEDL+Pro19ca.Pro261 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
KLK2A2; HK2; Prostatic Kallikrein-Related Peptidase 2; Glandular kallikrein-1; Tissue kallikrein-2 |
Similar products |
HK2, Glandular kallikrein-1, Tissue kallikrein-2, KLK2A2, Prostatic Kallikrein-Related Peptidase 2 |
Available |
|
Sequence |
EQKLISEEDL+Pro19ca.Pro261 |
Predicted Molecular Mass(KD) |
30.6kDa |
Purity |
> 90% |
Uniprot Link |
P20151 |
Subcellular location |
PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP |
Isoelectric Point |
7, 1 |
Item Name |
Kallikrein 2 |
Alternative Names |
KLK2A2, HK2, Prostatic Kallikrein-Related Peptidase 2, Glandular kallikrein-1, Tissue kallikrein-2 |
Buffer |
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. |
Traits |
Freeze-dried powder |
Tag |
N-terminal His Tag |
Research Area |
Enzyme & Kinase; |
Expression System |
Prokaryotic expression |
Appilcaiton info |
Positive Control, Immunogen, SDS-PAGE, WB. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.