Comparison

Noggin, Human Recombinant

Item no. 228-20195-2
Manufacturer Raybiotech
Amount 20 ug
Quantity options 20 ug 1000 ug
Category
Type Proteins
Format Lyophilized
Specific against Human (Homo sapiens)
Host E.coli
Purity Greater than 95.0% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Category
Proteins|Recombinant Proteins|Human Proteins
Shipping Temperature
Ambient temperature
Storage Conditions
-20°C
UNSPSC Code
12352202
Formulation
Lyophilized from a 0.2 umfiltered solution in 30% CH3CN, 0.1% TFA.
Expressed Region
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Protein Name & Synonyms
SYM1, SYNS1, NOG.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.
Biological activity
The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 ug/ml of Noggin, corresponding to a Specific Activity of 12, 500-20, 00
Protein Content
Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 1.76 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of Noggin as a Reference Standard.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close