« Back
Home /
Noggin, Human Recombinant

Noggin, Human Recombinant

Item no.	228-20195-3
Manufacturer	Raybiotech
Amount	1 mg
Quantity options	20 ug 1 mg
Category	Neuroscience Neural Lineage Markers Neural Signaling Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 95.0% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Shipping condition	Room temperature
Available
Manufacturer - Category	Proteins and Peptides\|Recombinant Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized from a 0.2 umfiltered solution in 30% CH3CN, 0.1% TFA.
Expressed Region	MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Protein Name & Synonyms	SYM1, SYNS1, NOG.
UNSPSC Code	12352202
Protein Content	Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 1.76 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of Noggin as a Reference Standard.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

228-20195-3.pdf

228-20195-3-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 7/31/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail