« Back
Home /
Recombinant Human FABP1/L-FABP Protein

Recombinant Human FABP1/L-FABP Protein

Item no.	RP00501-20ug
Manufacturer	Abclonal
Amount	20 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against	Human (Homo sapiens)
Purity	> 97% by SDS-PAGE.
NCBI	FABP1/L-FABP
Alias	FABP1,FABPL,L-FABP,L-FABP
Available
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	14.92 kDa
Description	Recombinant Human FABP1/L-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2-Ile127) of human FABP1/L-FABP (Accession #P07148) fused with a His tag at the N-terminus.
Background	Human Fatty Acid-Binding Protein 1 (FABP1) is a cytoplasm protein, which belongs to the calycin superfamilyand Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP1 forms a beta-barrel structure that accommodateshydrophobic ligands in its interior. FABP1 can bind free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm, so it can be involved in intracellular lipid transport.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ser2-Ile127
Route	N-His
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	14.92 kDa
Gene Symbol	FABP1/L-FABP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00501-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer