« Back
Home /
Recombinant Mouse IFN-beta Protein

Recombinant Mouse IFN-beta Protein

Item no.	RP01883-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
NCBI	Ifnb1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ifnb1,Ifb,Ifnb,Interferon beta,IFN-beta
Available
Manufacturer - Applications	<0.1EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.73 kDa
Description	Recombinant Mouse IFN-beta Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile 22 -Asn 182) of Mouse IFN-beta (Accession #NP_034640.1) fused with no tag.
Background	Interferon beta (IFN-beta ), also known as fibroblast IFN, is a secreted, approximately 22 kDa member of the type I interferon family of molecules . Mature mouse IFN-beta shares 75% and 47% amino acid sequence identity with the rat and human proteins, respectively. Fibroblasts are the major producers of IFN-beta, but it can also be produced by dendritic cells, macrophages, and endothelial cells in response to pathogens . It is transcriptionally regulated by TRAF3, IRF3, IRF7, and NF-kappa B . IFN-beta -deficient mice show increased susceptibility to experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS) . Furthermore, IFN-beta has been shown to suppress the Th17 cell response in both MS and EAE and has commonly been used as a treatment for MS . IFN-beta can additionally induce the expression of the anti-inflammatory cytokine IL-10 .
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ile 22 -Asn 182
Route	No-tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	19.73 kDa
Gene Symbol	Ifnb1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP01883-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer