ABflo® 488 Rabbit anti-Human/Mouse BCL6 mAb

FC (intra)

ABflo® 488. Ex:491nm. Em:516nm.

Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1).

Recombinant protein

ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS

72kDa/78kDa