Comparison

ABflo® 488 Rabbit anti-Human/Mouse BCL6 mAb European Partner

Item no. A23847-20ul
Manufacturer Abclonal
Amount 20 ul
Quantity options 100 ul 20 ul
Applications FC
Specific against Human (Homo sapiens)
Isotype IgG
Purity Affinity purification
NCBI BCL6
Alias BCL6,BCL5,BCL6A,LAZ3,ZBTB27,ZNF51,B-cell CLL/lymphoma 6
Shipping Condition Cool pack
Available
Manufacturer - Applications
FC (intra)
Manufacturer - Category
Monoclonal Antibodies
Manufacturer - Conjugate / Tag
ABflo® 488. Ex:491nm. Em:516nm.
Shipping Temperature
ice pack
Storage Conditions
Store at 2-8°C. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight
72kDa/78kDa
Background
The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 responses of B cells. This protein can interact with a variety of POZ-containing proteins that function as transcription corepressors. This gene is found to be frequently translocated and hypermutated in diffuse large-cell lymphoma (DLCL), and may be involved in the pathogenesis of DLCL. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 235-350 of human BCL6(NP_001124317.1).
Protein Size
72kDa/78kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Transcription Factors, Cancer, Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, B Cell Receptor Signaling Pathway.
Antigen Seq
ARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS
Manufacturer - Gene ID (Human)
604
Expected Protein Size
72kDa/78kDa
Gene Symbol
BCL6

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close