« Back
Home /
Timm29 Rabbit pAb

Timm29 Rabbit pAb

Item no.	A20812-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, IP, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
NCBI	Timm29
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TIM29, 1810026J23Rik, Timm29
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background	Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 157-266 of mouse Timm29 (NP_848734.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IP, 1:500 - 1:1000
Protein Size	29kDa
Route	Recombinant protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A20812-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer