« Back
Home /
Recombinant Human Urokinase plasminogen activator surface receptor(PLAUR)

Recombinant Human Urokinase plasminogen activator surface receptor(PLAUR)

Manufacturer	Cusabio
Category	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP018122HU-200
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cancer
Uniprot ID	Q03405
Gene Names	PLAUR
Organism	Homo sapiens (Human)
AA Sequence	LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEG EELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVV CGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSC ERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKD DRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTK CNEGPILELENLPQNGRQCYSCKGNSTHGCSSEET FLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATAS MCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQY RSG
Expression Region	23-305aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	58.5 kDa
Alternative Name(s)	Monocyte activation antigen Mo3; CD87
Relevance	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Reference	Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis.Roldan A.L., Cubellis M.V., Masucci M.T., Behrendt N., Lund L.R., Danoe K., Appella E., Blasi F.EMBO J. 9:467-474(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Subcellular Location	Cell membrane, Cell projection, invadopodium membrane
Tissue Specificity	Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
Paythway	Complementandcoagulationcascades
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018122HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time