Comparison

Recombinant Human Urokinase plasminogen activator surface receptor(PLAUR)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP018122HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Monocyte activation antigen Mo3; CD87
AA Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEG EELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVV CGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSC ERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKD DRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTK CNEGPILELENLPQNGRQCYSCKGNSTHGCSSEET FLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATAS MCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQY RSG
Research Topic
Cancer
Uniprot ID
Q03405
Gene Names
PLAUR
Tag Info
N-terminal GST-tagged
Expression Region
23-305aa
MW of Fusion Proten
58, 5
Sequence Info
Full Length
Relevance
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Reference
Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis.Roldan A.L., Cubellis M.V., Masucci M.T., Behrendt N., Lund L.R., Danoe K., Appella E., Blasi F.EMBO J. 9:467-474(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close