Comparison

Recombinant Human Urokinase plasminogen activator surface receptor(PLAUR)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP018122HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
Q03405
Gene Names
PLAUR
Organism
Homo sapiens (Human)
AA Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEG EELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVV CGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSC ERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKD DRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTK CNEGPILELENLPQNGRQCYSCKGNSTHGCSSEET FLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATAS MCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQY RSG
Expression Region
23-305aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
58.5 kDa
Alternative Name
Monocyte activation antigen Mo3. CD87
Relevance
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Reference
Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis.Roldan A.L., Cubellis M.V., Masucci M.T., Behrendt N., Lund L.R., Danoe K., Appella E., Blasi F.EMBO J. 9:467-474(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Subcellular Location
Cell membrane, Cell projection, invadopodium membrane
Tissue Specificity
Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain.
Paythway
Complementandcoagulationcascades
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close