« Back
Home /
Recombinant Glycine max Gamma-glutamyl hydrolase

Recombinant Glycine max Gamma-glutamyl hydrolase

Item no.	CSB-EP009389GGV-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVI GILTHPGDGASGRLSNATGVSYIAASYVKFVESGG ARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSG PYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLV IRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSL FQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNT KLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNL WQP
Protein Family	Peptidase C26 family
Citations	"Purification and molecular analysis of an Extracellular domain gamma-glutamyl hydrolase present in young tissues of the soybean plant." Huangpu J., Pak J.H., Burkhart W., Graham M.C., Rickle S.A., Graham J.S.Biochem. Biophys. Res. Commun. 228:1-6(1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Conjugase,GH,Gamma-Glu-X carboxypeptidase
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	51.3 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	Hydrolysis of a gamma-glutamyl bond.
Expression Region	22-342aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Secreted, extracellular space, Secreted, cell wall
Tissue Specificity	Expressed only in young (1-15 day old) leaf, stem and root tissue.
Sequence Info	Full Length of Mature Protein
Organism	Glycine max (Soybean) (Glycine hispida)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP009389GGV-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer