« Back
Home /
Recombinant Human Mannose-6-phosphate isomerase(MPI)

Recombinant Human Mannose-6-phosphate isomerase(MPI)

Item no.	CSB-EP014754HU-100
Manufacturer	Cusabio
Amount	100ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Phosphohexomutase,Phosphomannose isomerase
Available
Research Areas	Signal Transduction
Uniprot ID	P34949
Gene Names	MPI
Organism	Homo sapiens (Human)
AA Sequence	AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDP LAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTL SQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETP LSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIA LTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAA THLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVE QLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYP GDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKG DCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTP SSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTE VPGSVTEYKVLALDSASILLMVQGTVIASTPTTQT PIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACC LL
Expression Region	1-423aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	73.5 kDa
Alternative Name(s)	Phosphohexomutase Phosphomannose isomerase
Relevance	Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Reference	Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib). Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G. Hum. Mutat. 16:247-252(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Involvement in disease	Congenital disorder of glycosylation 1B (CDG1B)
Subcellular Location	Cytoplasm
Protein Families	Mannose-6-phosphate isomerase type 1 family
Tissue Specificity	Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP014754HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time