« Back
Home /
Recombinant Human Nicotinate phosphoribosyltransferase(NAPRT),partial

Recombinant Human Nicotinate phosphoribosyltransferase(NAPRT),partial

Item no.	CSB-EP015451HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQE PHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLP NFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRK VFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQ PRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDML QLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPL LRL
Protein Family	NAPRTase family
Citations	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	60.2 kDa
General Research Areas	Metabolism
Relevance	Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Expression Region	229-538aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Subcellular Location	Cytoplasm, cytosol
Gene Names	NAPRT1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015451HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer