Comparison

Recombinant Rat Perforin-1(Prf1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018668RA-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P35763
Gene Names
Prf1
Organism
Rattus norvegicus (Rat)
AA Sequence
ATRSECKQNHKFVPGVWAAGEGVDVTTLRRSSSFP VNTGKFLRPDRTCTLCKNALMNDGIQRLPVAIAHW RPHGSHCQRNVATTKVSSTEGVAREAAANINNDWR AGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQD QYNFNTDTVECRMYSFRLAQKPPLHPDFRKALKNL PHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSV LTALRTCQLTLDGLTADEVGDCLSVEAQVSIGAQA SVSSEYKACEEKKKQHKIATSFHQTYRERHVEVLG GPLDSSNDLLFGNQATPEHFSTWIASLPTRPDVVD YSLEPLHILLEDSDPKREALRQAISHYVMSRARWR DCNRPCRAGQHKSSRDSCQCVCQDSNVTNQDCCPR QRGLAKLMVRNFQAKGLWGDYITSTDAYLKVFFGG QEIRTGVVWNNNHPSWSDKMDFGNVLLSTGGPLRV QVWDADNGWDDDLLGTCDKSPKSGFHEVNCPLNHG SIKFIYQANCLPDLTGETCLEYAPQGLLGDPRGNR SGAVW
Expression Region
25-554aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
62.9 kDa
Alternative Name
Cytolysin. Lymphocyte pore-forming protein
Relevance
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the mbrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Reference
Molecular cloning of rat cytolysin.Ishikawa H., Shinkai Y., Yagita H., Yue C.C., Henkart P.A., Sawada S., Young H.A., Reynolds C.W., Okumura K.J. Immunol. 143:3069-3073(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Subcellular Location
Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen
Protein Families
Complement C6/C7/C8/C9 family
Tissue Specificity
Detected in large granular lymphocytes and lymphokine-activated killer cells.
Amount: 1mg
Available: In stock
Listprice: €2,191.83
Price: €2,191.83
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close