Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Host |
E.coli |
Item no. |
CSB-EP018668RA-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P35763 |
Gene Names |
Prf1 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
ATRSECKQNHKFVPGVWAAGEGVDVTTLRRSSSFP VNTGKFLRPDRTCTLCKNALMNDGIQRLPVAIAHW RPHGSHCQRNVATTKVSSTEGVAREAAANINNDWR AGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQD QYNFNTDTVECRMYSFRLAQKPPLHPDFRKALKNL PHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSV LTALRTCQLTLDGLTADEVGDCLSVEAQVSIGAQA SVSSEYKACEEKKKQHKIATSFHQTYRERHVEVLG GPLDSSNDLLFGNQATPEHFSTWIASLPTRPDVVD YSLEPLHILLEDSDPKREALRQAISHYVMSRARWR DCNRPCRAGQHKSSRDSCQCVCQDSNVTNQDCCPR QRGLAKLMVRNFQAKGLWGDYITSTDAYLKVFFGG QEIRTGVVWNNNHPSWSDKMDFGNVLLSTGGPLRV QVWDADNGWDDDLLGTCDKSPKSGFHEVNCPLNHG SIKFIYQANCLPDLTGETCLEYAPQGLLGDPRGNR SGAVW |
Expression Region |
25-554aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
62.9 kDa |
Alternative Name(s) |
Cytolysin; Lymphocyte pore-forming protein |
Relevance |
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the mbrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. |
Reference |
Molecular cloning of rat cytolysin.Ishikawa H., Shinkai Y., Yagita H., Yue C.C., Henkart P.A., Sawada S., Young H.A., Reynolds C.W., Okumura K.J. Immunol. 143:3069-3073(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes. |
Subcellular Location |
Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen |
Protein Families |
Complement C6/C7/C8/C9 family |
Tissue Specificity |
Detected in large granular lymphocytes and lymphokine-activated killer cells. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.