« Back
Home /
Recombinant Rat Perforin-1(Prf1),partial

Recombinant Rat Perforin-1(Prf1),partial

Item no.	CSB-EP018668RA-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATRSECKQNHKFVPGVWAAGEGVDVTTLRRSSSFP VNTGKFLRPDRTCTLCKNALMNDGIQRLPVAIAHW RPHGSHCQRNVATTKVSSTEGVAREAAANINNDWR AGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQD QYNFNTDTVECRMYSFRLAQKPPLHPDFRKALKNL PHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSV LTALRTCQLTLDGLTADEVGDCLSVEAQVSIGAQA SVS
Protein Family	Complement C6/C7/C8/C9 family
Citations	Molecular cloning of rat cytolysin.Ishikawa H., Shinkai Y., Yagita H., Yue C.C., Henkart P.A., Sawada S., Young H.A., Reynolds C.W., Okumura K.J. Immunol. 143:3069-3073(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytolysin;Lymphocyte pore-forming protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	62.9 kDa
Relevance	Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the mbrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Expression Region	25-554aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Subcellular Location	Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen
Tissue Specificity	Detected in large granular lymphocytes and lymphokine-activated killer cells.
Gene Names	Prf1
Sequence Info	Partial
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018668RA-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer