Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP020336MO-1 |
Conjugate/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
Rplp0 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P14869 |
AA Sequence |
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAP AAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGL FD |
Tag Info |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Expression Region |
1-317aa |
Protein Length |
Full Length |
MW |
54.2 kDa |
Distributor Discount |
50% off the list price |
Alternative Name(s) |
60S ribosomal protein L10E |
Relevance |
Ribosomal protein P0 is the functional equivalent of E.coli protein L10. |
Reference |
The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control. Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Ribosomal protein P0 is the functional equivalent of E.coli protein L10. |
Subcellular Location |
Nucleus, Cytoplasm |
Protein Families |
Universal ribosomal protein uL10 family |
Tag Information |
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.