Comparison

Recombinant Human herpesvirus 1 Tegument protein VP16 (UL48)

Item no. CSB-EP356268HWZ-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDLLVDELFADMDADGASPPPPRPAGGPKNTPAAP PLYATGRLSQAQLMPSPPMPVPPAALFNRLLDDLG FSAGPALCTMLDTWNEDLFSALPTNADLYRECKFL STLPSDVVEWGDAYVPERAQIDIRAHGDVAFPTLP ATRDGLGLYYEALSRFFHAELRAREESYRTVLANF CSALYRYLRASVRQLHRQAHMRGRDRDLGEMLRAT IADRYYRETARLARVLFLHLYLFLTREILWAAYAE QMM
Protein Family Herpesviridae tegument protein VP16 protein family
Citations Comprehensive characterization of extracellular herpes simplex virus type 1 virions.Loret S., Guay G., Lippe R.J. Virol. 82:8605-8618(2008)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Alpha trans-inducing protein; Alpha-TIF; ICP25; Vmw65
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
70.3 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Transcriptional activator of immediate-early (IE) gene products (alpha genes). Acts as a key activator of lytic infection by initiating the lytic program through the assembly of the transcriptional regulatory VP16-induced complex composed of VP16 and two cellular factors, HCFC1 and POU2F 1. VP16-induced complex represents a regulatory switch: when it is on, it promotes IE-gene expression and thus lytic infection, and when it is off, it limits IE-gene transcription favoring latent infection (By similarity).By similarity1 Publication
May play a role in the aggregation of tegument proteins around nucleocapsids during virus morphogenesis.
Expression Region
1-490aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcriptional activator of immediate-early (IE) gene products (alpha genes). Acts as a key activator of lytic infection by initiating the lytic program through the assembly of the transcriptional regulatory VP16-induced complex composed of VP16 and two cellular factors, HCFC1 and POU2F 1. VP16-induced complex represents a regulatory switch
Subcellular Location
Virion tegument, Host nucleus
Gene Names
UL48
Sequence Info
Full Length
Organism
Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close