Comparison

Recombinant Human Membrane-associated phosphatidylinositol transfer protein 1(PITPNM1),partial

Item no. CSB-RP019954h-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSG EGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIP GWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVE KFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDT IDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDD WARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFI HDVGLRRVMLRAHRQAWCWQDEWTELSM
Protein Family PtdIns transfer protein family, PI transfer class IIA subfamily
Citations Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Drosophila retinal degeneration B homologPhosphatidylinositol transfer protein, membrane-associated 1 ;PITPnm 1;Pyk2 N-terminal domain-interacting receptor 2 ;NIR-2
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
54.5 kDa
General Research Areas
Transport
Relevance
Regulates RHOA activity, and plays a role in cytoskeleton rodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between mbranes . Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.4 Publications
Expression Region
1-238aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulates RHOA activity, and plays a role in cytoskeleton remodeling. Necessary for normal completion of cytokinesis. Plays a role in maintaining normal diacylglycerol levels in the Golgi apparatus. Binds phosphatidyl inositol phosphates (in vitro). May catalyze the transfer of phosphatidylinositol and phosphatidylcholine between membranes (By similarity). Necessary for maintaining the normal structure of the endoplasmic reticulum and the Golgi apparatus. Required for protein export from the endoplasmic reticulum and the Golgi. Binds calcium ions.
Subcellular Location
Cytoplasm, Golgi apparatus, Golgi stack membrane, Peripheral membrane protein, Endoplasmic reticulum membrane, Peripheral membrane protein, Lipid droplet, Cleavage furrow, Midbody
Tissue Specificity
Ubiquitous.
Gene Names
PITPNM1
Sequence Info
Partial
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close