« Back
Home /
Recombinant Human Rhombotin-1(LMO1),partial

Recombinant Human Rhombotin-1(LMO1),partial

Item no.	CSB-RP020544h-1
Manufacturer	Cusabio
Amount	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cysteine-rich protein TTG-1LIM domain only protein 1 ;LMO-1T-cell translocation protein 1
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	P25800
Gene Names	LMO1
Organism	Homo sapiens (Human)
AA Sequence	DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKA LDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILC RRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVY HLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEE GQLNGTFESQVQ
Expression Region	5-156aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	44.4 kDa
Alternative Name(s)	Cysteine-rich protein TTG-1LIM domain only protein 1 ; LMO-1T-cell translocation protein 1
Relevance	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Reference	Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Involvement in disease	A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11, 14)(p15; q11) with TCRD.
Subcellular Location	Nucleus
Tissue Specificity	Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time