Comparison

Recombinant Human Activator of 90KDA heat shock protein ATPase homolog 1(AHSA1)

Item no. CSB-RP054544h-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAKWGEGDPRWIVEERADATNVNNWHWTERDASNW STDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASI NNRKGKLIFFYEWSVKLNWTGTSKSGVQYKGHVEI PNLSDENSVDEVEISVSLAKDEPDTNLVALMKEEG VKLLREAMGIYISTLKTEFTQGMILPTMNGESVDP VGQPALKTEERKAKPAPSKTQARPVGVKIPTCKIT LKETFLTSPEELYRVFTTQELVQAFTHAPATLEAD RGG
Protein Family AHA1 family
Citations Isolation of a novel gene underexpressed in Down syndrome.Michaud J., Chrast R., Rossier C., Papassavas M.P., Antonarakis S.E., Scott H.S.Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias p38
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
65.3 kDa
General Research Areas
Neuroscience
Relevance
Cochaperone that stimulates HSP90 ATPase activity . May affect a step in the endoplasmic reticulum to Golgi trafficking.
Expression Region
1-338aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a co-chaperone of HSP90AA1. Activates the ATPase activity of HSP90AA1 leading to increase in its chaperone activity. Competes with the inhibitory co-chaperone FNIP1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins
Subcellular Location
Cytoplasm, cytosol, Endoplasmic reticulum
Tissue Specificity
Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta.
Gene Names
AHSA1
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close