« Back
Home /
Recombinant Rat Haptoglobin(Hp),partial

Recombinant Rat Haptoglobin(Hp),partial

Item no.	CSB-RP170694r-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Drugs Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VELGNDATDIEDDSCPKPPEIANGYVEHLVRYRCR QFYKLQTEGDGIYTLNSEKQWVNPAAGDKLPKCEA VCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISR HGLTTGATLISDQWLLTTAQNLFLNHSENATAKDI APTLTLYVGKNQLVEIEKVVLHPERSVVDIGLIKL KQKVLVTEKVMPICLPSKDYVAPGRMGYVSGWGRN VNFRFTERLKYVMLPVADQEKCELHYEKSTVPEKK GAV
Protein Family	Peptidase S1 family
Citations	Structure, hormonal regulation, and identification of the interleukin-6- and dexamethasone-responsive element of the rat haptoglobin gene.Marinkovic S., Baumann H.Mol. Cell. Biol. 10:1573-1583(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Liver regeneration-related protein LRRG173Zonulin
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	40.5 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	As a result of holysis, hoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hoglobin to allow hepatic recycling of he iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway .Uncleaved haptoglogin, also known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassbly, and controlling the equilibrium between tolerance and immunity to non-self antigens.
Expression Region	19-346aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway (By similarity).
Subcellular Location	Secreted
Tissue Specificity	Expressed by the liver and secreted in plasma.
Gene Names	HP
Sequence Info	Partial
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-RP170694r-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer