« Back
Home /
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Manufacturer	Cusabio
Category	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	Yeast
Item no.	CSB-YP008532HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P12319
Gene Names	FCER1A
Organism	Homo sapiens (Human)
AA Sequence	VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFL RCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQ
Expression Region	26-205aa
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	23 kDa
Alternative Name(s)	Fc-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Reference	"High-level expression of the truncated alpha chain of human high-affinity receptor for IgE as a soluble form by baculovirus-infected insect cells. Biochemical characterization of the recombinant product."Yagi S., Yanagida M., Tanida I., Hasegawa A., Okumura K., Ra C.Eur. J. Biochem. 220:593-598(1994).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Paythway	FcepsilonRIsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time