« Back
Home /
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Item no.	CSB-YP008532HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQH QQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFL RCHGWRNWDVYKVIYYKDGEALKYWYENHNISITN ATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPRE KYWLQ
Citations	"High-level expression of the truncated alpha chain of human high-affinity receptor for IgE as a soluble form by baculovirus-infected insect cells. Biochemical characterization of the recombinant product."Yagi S., Yanagida M., Tanida I., Hasegawa A., Okumura K., Ra C.Eur. J. Biochem. 220:593-598(1994).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc-epsilon RI-alpha,FcERI,IgE Fc receptor subunit alpha
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	23 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Expression Region	26-205aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Pathway	FcepsilonRIsignalingpathway
Gene Names	FCER1A
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP008532HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer