« Back
Home /
Recombinant Mouse Erythroferrone(Erfe)

Recombinant Mouse Erythroferrone(Erfe)

Item no.	CSB-YP757647MO-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Metabolism Glucose Homeostasis Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LGVPESAEPVGTHARPQPPGAELPAPPANSPPEPT IAHAHSVDPRDAWMLFVKQSDKGINSKRRSKARRL KLGLPGPPGPPGPQGPPGPFIPSEVLLKEFQLLLK GAVRQRESHLEHCTRDLTTPASGSPSRVPAAQELD SQDPGALLALLAATLAQGPRAPRVEAAFHCRLRRD VQVDRRALHELGIYYLPEVEGAFHRGPGLNLTSGQ YTAPVAGFYALAATLHVALTEQPRKGPTRPRDRLR LLI
Protein Family	Adipolin/erythroferrone family
Citations	"Myonectin (CTRP15), a novel myokine that links skeletal muscle to systemic lipid homeostasis."Seldin M.M., Peterson J.M., Byerly M.S., Wei Z., Wong G.W.J. Biol. Chem. 287:11968-11980(2012)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Complement C1q tumor necrosis factor-related protein 15; Myonectin
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.9 kDa
Relevance	Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage: produced by erythroblasts following blood loss and mediates suppression of hepcidin (HAMP) expression in the liver, thereby promoting increased iron absorption and mobilization from stores (PubMed:24880340). Promotes lipid uptake into adipocytes and hepatocytes via transcriptional up-regulation of genes involved in fatty acid uptake
Expression Region	25-340aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage
Subcellular Location	Secreted
Tissue Specificity	Predominantly expressed in skeletal muscle and, at much lower levels, in other tissues, including lung, eye, smooth muscle, heart, brain and kidney. Within skeletal muscles, higher expression levels in soleus as compared with plantaris. Found in blood (at protein level). Following EPO treatment, only expressed in bone marrow and spleen (PubMed:24880340). Females tend to have higher circulating levels than males. Obese mice tend to have lower expression and circulating levels as compared to lean animals.
Gene Names	Erfe
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP757647MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer