Comparison

Recombinant Mouse Erythroferrone(Erfe)

Item no. CSB-YP757647MO-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LGVPESAEPVGTHARPQPPGAELPAPPANSPPEPT IAHAHSVDPRDAWMLFVKQSDKGINSKRRSKARRL KLGLPGPPGPPGPQGPPGPFIPSEVLLKEFQLLLK GAVRQRESHLEHCTRDLTTPASGSPSRVPAAQELD SQDPGALLALLAATLAQGPRAPRVEAAFHCRLRRD VQVDRRALHELGIYYLPEVEGAFHRGPGLNLTSGQ YTAPVAGFYALAATLHVALTEQPRKGPTRPRDRLR LLI
Protein Family Adipolin/erythroferrone family
Citations Myonectin (CTRP15), a novel myokine that links skeletal muscle to systemic lipid homeostasis.Seldin M.M., Peterson J.M., Byerly M.S., Wei Z., Wong G.W.J. Biol. Chem. 287:11968-11980(2012)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Complement C1q tumor necrosis factor-related protein 15; Myonectin
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
35.9 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage: produced by erythroblasts following blood loss and mediates suppression of hepcidin (HAMP) expression in the liver, thereby promoting increased iron absorption and mobilization from stores (PubMed:24880340). Promotes lipid uptake into adipocytes and hepatocytes via transcriptional up-regulation of genes involved in fatty acid uptake
Expression Region
25-340aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage
Subcellular Location
Secreted
Tissue Specificity
Predominantly expressed in skeletal muscle and, at much lower levels, in other tissues, including lung, eye, smooth muscle, heart, brain and kidney. Within skeletal muscles, higher expression levels in soleus as compared with plantaris. Found in blood (at protein level). Following EPO treatment, only expressed in bone marrow and spleen (PubMed:24880340). Females tend to have higher circulating levels than males. Obese mice tend to have lower expression and circulating levels as compared to lean animals.
Gene Names
Erfe
Sequence Info
Full Length of Mature Protein
Organism
Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close