Comparison

Recombinant Human TREM2 Protein European Partner

Item no. RP00322-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE
Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
NCBI TREM2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD274,PDL1,PD-L1,PD-L1B7 homolog 1,B7-H,B7H1,B7-H1,PDCD1L1,PDCD1LG1
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
44.2 kDa
Description
Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of Human TREM2 (Accession #Q9NZC2-1) fused with a C-hFc tag at the C-terminus.
Background
TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2? consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. TREM-2 forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His19-Ser174
Route
C-hFc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Bioactivity
Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 0. 01-0. 06 μg/mL. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0. 03-0. 1 μg/mL.
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS, 100 mM Arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
44.2 kDa
Gene Symbol
TREM2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close