« Back
Home /
Recombinant Human TREM2 Protein

Recombinant Human TREM2 Protein

Item no.	RP00322-100ug
Manufacturer	Abclonal
Amount	100 ug
Quantity options	100 ug 10 ug 50 ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE
NCBI	TREM2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CD274,PDL1,PD-L1,PD-L1B7 homolog 1,B7-H,B7H1,B7-H1,PDCD1L1,PDCD1LG1
Available
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	44.2 kDa
Description	Recombinant Human TREM2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His19-Ser174) of Human TREM2 (Accession #Q9NZC2-1) fused with a C-hFc tag at the C-terminus.
Background	TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2? consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. TREM-2 forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed:10799849). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	His19-Ser174
Route	C-hFc
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS, 100 mM Arginine (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	44.2 kDa
Gene Symbol	TREM2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00322-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer