Recombinant Mouse IL-15RA/CD215 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15.Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, orgamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cellspresents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide varietyof Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with themouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting fromalternative splicing events involving different exons.

Gly33-Lys205

<0.1EU/μg

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

IL-15RA/CD215