Item no. |
RP01373-50ug |
Manufacturer |
Abclonal
|
Amount |
50 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
NCBI |
IL-15RA/CD215 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
IL-15RA,CD215,AA690181,IL15RA |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Applications |
<0.1EU/μg |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
45.16 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Mouse IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL15RA/CD215 (Accession #NP_032384.1) fused with a Fc, 6×His tag at the C-terminus. |
Background |
Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15.Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, orgamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cellspresents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide varietyof Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with themouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting fromalternative splicing events involving different exons. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Gly33-Lys205 |
Route |
C-hFc&His |
Endotoxin |
<0.1EU/μg |
Manufacturer - Research Area |
Bio-Markers & CD Antigens, Interleukin |
Antigen Seq |
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
Bioactivity |
Measured by its binding ability in a functional ELISA.Immobilized Human IL15 at 1 μg/mL (100 μL/well) can bind Mouse IL15RA with a linear range of 0. 3-77 ng/mL. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
45.16 kDa |
Gene Symbol |
IL-15RA/CD215 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.