Item no. |
RP01587-1000ug |
Manufacturer |
Abclonal
|
Amount |
1000 ug |
Quantity options |
1000 ug
100 ug
10 ug
20 ug
500 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 95% by SDS-PAGE. |
NCBI |
Pahormone/PTH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
PTH,PTH1,parathyroid hormone,PTH1 |
Shipping condition |
Cool pack |
Available |
|
Manufacturer - Applications |
<0.1EU/μg |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
9.42 kDa |
Description |
Recombinant Human Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser32-Gln115) of human Parathormone/PTH (Accession #NP_000306.1) fused with no additional amino acid. |
Background |
Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration inextracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cellsin bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor asparathyroid hormone and has major effects on development. Like most other protein hormones, parathyroidhormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packagedwithin the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secretedas a linear protein of 84 amino acids. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Ser32-Gln115 |
Recommended Dilution |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Route |
No tag |
Manufacturer - Research Area |
Other Recombinant Protein |
Antigen Seq |
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
9.42 kDa |
Gene Symbol |
Pahormone/PTH |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.