Comparison

Recombinant Human Parathormone/PTH Protein European Partner

Item no. RP01587-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
NCBI Pahormone/PTH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PTH,PTH1,parathyroid hormone,PTH1
Shipping Condition Cool pack
Available
Manufacturer - Applications
<0.1EU/μg
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
9.42 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser32-Gln115) of human Parathormone/PTH (Accession #NP_000306.1) fused with no additional amino acid.
Background
Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration inextracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cellsin bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor asparathyroid hormone and has major effects on development. Like most other protein hormones, parathyroidhormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packagedwithin the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secretedas a linear protein of 84 amino acids.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ser32-Gln115
Route
No tag
Endotoxin
<0.1EU/μg
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
9.42 kDa
Gene Symbol
Pahormone/PTH

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close