Comparison

Recombinant Human Antigen KI-67(MKI67),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014597HU(A5)-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P46013
Gene Names
MKI67
Organism
Homo sapiens (Human)
AA Sequence
TKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADK EPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRA PRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIP CKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVG KLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRKLD AEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPG HTEELANGAADSFTSAPKQTPDSGKPLKISRRVLR APKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRG GGKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVA PRARGKSSEPVVIMKRSLRTSAKRIEPAEELNSND MKTNKEEHKLQDSVPENKGISLRSRRQNKTEAEQQ ITEVFVLAERIEINRNEKKPMKTSPEMDIQNPDDG ARKPIPRDKVTENKRCLRSARQNESSQPKVAEESG GQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQP AASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKK IRTRSHRDSEDI
Expression Region
2720-3256aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
75.1 kDa
Relevance
Thought to be required for maintaining cell proliferation.
Reference
"The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins."Schlueter C., Duchrow M., Wohlenberg C., Becker M.H.G., Key G., Flad H.-D., Gerdes J.J. Cell Biol. 123:513-522(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location
Chromosome, Nucleus, Nucleus, nucleolus
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close