Comparison

Recombinant Human Polyadenylate-binding protein 1(PABPC1),partial

Item no. CSB-EP017352HU-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAG PILSIRVCRDMITRRSLGYAYVNFQQPADAERALD TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKN LDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS RKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQ KAV
Protein Family Polyadenylate-binding protein type-1 family
Citations Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination.Skourti-Stathaki K., Proudfoot N.J., Gromak N.Mol. Cell 42:794-805(2011)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Targets
PABPC1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
57.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in Cytoplasmic domain regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to Cytoplasmic domain RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the Cytoplasmic domain deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing prature stop codons; for the recognition of prature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed.
Biologically Active
Not Test
Expression Region
1-370aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRNA stability
Subcellular Location
Cytoplasm, Nucleus
Tissue Specificity
Ubiquitous.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close