Comparison

Recombinant Human Vitamin K-dependent protein S(PROS1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP018754HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
ANSLLEETKQGNLERECIEELCNKEEAREVFENDP ETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLR SCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCK PGWQGEKCEFDINECKDPSNINGGCSQICDNTPGS YHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAV CKNIPGDFECECPEGYRYNLKSKSCEDIDECSENM CAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVS VCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEIS RFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRG GKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEEL EHSISIKIAKEAVMDINKPGPLFKPENGLLETKVY FAGFPRKVESELIKPINPRLDGCIRSWNLMKQGAS GIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHID YNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNN TVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALS LCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQ RQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFY NGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWK KTKNS
Research Topic
Cardiovascular
Uniprot ID
P07225
Gene Names
PROS1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
42-676aa
MW of Fusion Proten
86, 6
Sequence Info
Full Length
Relevance
Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
Reference
Human protein S cDNA encodes Phe-16 and Tyr 222 in consensus sequences for the post-translational processing.Ploos van Amstel H.K., van der Zanden A.L., Reitsma P.H., Bertina R.M.FEBS Lett. 222:186-190(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close